PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim05g051460.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 314aa    MW: 35640.9 Da    PI: 4.4467
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim05g051460.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.52.2e-1864117356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k++++  +q+++Le+ Fe ++++  e++ +LA++lgL+ rqV +WFqNrRa++k
  Sopim05g051460.0.1  64 KKRRLRVDQVKALEKNFEVDNKLEPERKVKLAQELGLQPRQVAIWFQNRRARWK 117
                         45578899*********************************************9 PP

2HD-ZIP_I/II127.27.3e-4163155193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrl  +qvk+LE++Fe ++kLeperKv+la+eLglqprqva+WFqnrRAR+ktkqlE+dy++Lk+++d+lk++ e++++++e+L +e+
  Sopim05g051460.0.1  63 EKKRRLRVDQVKALEKNFEVDNKLEPERKVKLAQELGLQPRQVAIWFQNRRARWKTKQLERDYNVLKANFDSLKHNYESIQHDNEALLKEI 153
                         69*************************************************************************************9999 PP

         HD-ZIP_I/II  92 ke 93 
                         +e
  Sopim05g051460.0.1 154 NE 155
                         76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.15159119IPR001356Homeobox domain
SuperFamilySSF466899.84E-1961121IPR009057Homeodomain-like
SMARTSM003894.1E-1762123IPR001356Homeobox domain
PfamPF000461.3E-1564117IPR001356Homeobox domain
CDDcd000869.16E-1664120No hitNo description
Gene3DG3DSA:1.10.10.605.1E-1967126IPR009057Homeodomain-like
PRINTSPR000317.8E-69099IPR000047Helix-turn-helix motif
PROSITE patternPS00027094117IPR017970Homeobox, conserved site
PRINTSPR000317.8E-699115IPR000047Helix-turn-helix motif
PfamPF021838.0E-18119160IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MKRVRSNDSL GAPLISMCQN TADEENNWNN HAYSRDFQIQ SMLESLDDDE ATTYVEESGV  60
GSEKKRRLRV DQVKALEKNF EVDNKLEPER KVKLAQELGL QPRQVAIWFQ NRRARWKTKQ  120
LERDYNVLKA NFDSLKHNYE SIQHDNEALL KEINELKSKL HGGNSEIKIA VKEEAFDSES  180
DDKRTEQSNQ CNNSNTELNF DTIIMNPSIN FTDFKDGSSD SDSSAILNED NAVISSGAFL  240
IKSGSGSGSS SPDSNSSLNC FQFLESNEVN FSSSQFVKLE EHNFFNGEES CSTLLFTDEQ  300
APTLHWYCPD DWN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111119RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755170.0HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004240025.10.0PREDICTED: homeobox-leucine zipper protein ATHB-6
TrEMBLK4C1H70.0K4C1H7_SOLLC; Uncharacterized protein
STRINGSolyc05g051460.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27182453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.13e-67homeobox protein 6